Skip to main content

Table 1 Identified sequences within the MWCNT-induced peptidome

From: Nanoparticle exposure driven circulating bioactive peptidome causes systemic inflammation and vascular dysfunction

Peptide_Sequence Parent_Protein_Name Symbol Accession Homo-logue Source Peptide Mass Precursor Mass Prec. RTa Prec. DTb Prec. Merrc Prod. Merrd Peptide Score FDR
QDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSASLTRSSQSSHTSKYFGSLD Period circadian protein homolog 1 Per1 O35973   MEROPS 6731.1214 6750.1381 40.42 54.58 0.25 2.57 7.679 0.000
SFDQVDPVQSTFPTETGGLST von Willebrand factor D and EGF domain-containing protein Vwde A0A0N4SVZ4   SignalP 2194.0066 2213.0318 39.54 46.69 3.11 3.28 7.510 0.000
TERFGQGGAGPVGGQGPRGMGPGT Splicing factor proline- and glutamine-rich Sfpq Q8VIJ6   MEROPS 2209.0446 2228.0428 39.21 47.91 9.16 3.65 7.448 0.000
RYTQKAPQVSTPTLVEAARNLGRVGTKC Serum albumin Alb P07724   MEROPS, SignalP 3082.6458 3101.6650 29.18 51.67 0.27 5.34 7.275 0.000
GRPERQFFVKWQGMSYWHCSWVSELQ Chromodomain-helicase-DNA-binding protein 4 Chd4 Q6PDQ2   MEROPS 3309.5389 3328.5559 34.18 52.67 0.42 5.62 7.256 0.000
KDTCFSTEGPNLVTRCKD Serum albumin Alb P07724   MEROPS, SignalP 2108.9619 2127.9844 18.90 45.86 1.94 5.90 7.239 0.000
CKAADKDTCFSTEGPNLVTRCKD Serum albumin Alb P07724   MEROPS, SignalP 2654.1887 2673.2104 18.12 53.79 1.25 5.91 7.238 0.000
PAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGA Collagen alpha-1(II) chain Col2a1 P28481   MEROPS, SignalP 6659.1069 6678.1019 36.86 52.51 3.51 5.98 7.234 0.000
NKGPVKVVVGKTF Protein disulfide-isomerase A4 Pdia4 P08003   MEROPS 1353.8132 1372.8346 32.85 63.44 2.20 6.41 7.212 0.000
PPSRSNSEQPGSLHSSQGLQMGPVEESWFSSSPEYPQDENDRSVQAKLQEEASYHAFGL Receptor-interacting serine/threonine-protein kinase 1 Ripk1 Q60855   MEROPS 6499.9588 6518.9949 38.98 52.98 2.73 6.81 7.194 0.000
KCLREMYTTHEDVEVGRCVRRFAGVQCVWSYEMQQLFYENYEQNKKGYLRDL Chondroitin sulfate synthase 1 Chsy1 Q6ZQ11   SignalP 6563.0918 6582.0918 36.11 52.00 2.81 7.39 7.171 0.000
KDRGHREEGEDFSREYGHRVQDHRYPG Histidine rich calcium binding protein isoform CRA_a Hrc G5E8J6   SignalP 3293.5211 3312.5554 44.06 52.77 4.82 7.40 7.170 0.000
VCTAVEDTRPVMDRNTDGQDGAYAEGTTKWPAEENRPQGKPSTKKSQSSKGQEGESCLRT Dickkopf-related protein 4 Dkk4 Q8VEJ3   SignalP 6607.0786 6626.1046 40.69 57.90 1.15 7.76 7.158 0.000
MNLEEKPAPAA Apolipoprotein A-II Apoa2 P09813   SignalP 1151.5645 1170.5826 17.71 46.99 0.23 7.87 7.154 0.000
TMNNEKYPVNLSETRLGWNSFNCSLSKNSNKKDHFTFNNTLEWTARNNFDMVLSE Protein Vmn2r13 Vmn2r13 L7N1X2   SignalP 6524.0437 6543.0484 37.20 52.69 2.10 8.26 7.142 0.000
TSVPKRRRPSGNGGFLGDPYCSESPQESSCEDGEGSSVMSARQRSAAESSKLSCSDVPDLVR DNA repair protein complementing XP-G cells homolog Ercc5 P35689   MEROPS 6685.0674 6704.1050 37.74 53.39 2.88 8.50 7.135 0.000
KPSGLVMARKLLHLELKPAL Dual specificity mitogen-activated protein kinase kinase 1 Map2k1 P31938   MEROPS 2195.3340 2214.3732 41.79 47.98 9.48 9.58 7.109 0.000
YYVDSEGNRLSGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRALYQATYRDAYSG Proteasome subunit beta type-5 Psmb5 O55234   MEROPS 6677.1145 6696.1121 38.75 53.55 3.12 9.67 7.107 0.000
DLKLCDFGLARVADPDHDH Mitogen-activated protein kinase 1 Mapk1 P63085   MEROPS 2175.0167 2194.0272 37.28 47.00 3.62 10.35 7.093 0.000
GKEAYAEYHFRVGSEAEGYALQVSSY Fibrinogen alpha chain Fga E9PV24   MEROPS 2892.3354 2911.3501 26.92 50.14 1.29 10.95 7.083 0.000
SLCDLPVHSNKEWSQHLNGASHSRRCQLLLELYPEWNPDNDTGHTMGDPFMLQQSTN Matrin-3 Matr3 Q8K310   MEROPS 6642.0386 6661.0724 41.86 53.01 2.32 11.24 7.078 0.000
ELFQREVSSVELFSYA UDP-glucuronosyltransferase Ugt1a5 B2RT14   SignalP 1884.9258 1903.9390 30.24 88.84 2.73 11.73 7.071 0.000
RPCPTEQLSPSHPPLATCFGSDVDLQLEMAVPQPGQYVLVVEYVGEDSHQEMGVAVHTPQ Laminin subunit alpha-5 Lama5 Q61001   MEROPS 6608.1184 6627.1148 39.56 58.20 3.33 12.10 7.065 0.000
YLPSGQQLYMSKEM MCG3425 Vmn2r75 G5E8Z7   SignalP 1655.7688 1674.7799 39.43 53.63 4.38 12.62 7.058 0.000
SFDWLMEQKFDMTFSENSHNLYNAVHALAHALHEMNLQQADNQALGNGKGASSHCLKVNS Protein Gm10302 Vmn2r47 K7 N709 G3UYU1,K7N5W1 SignalP 6737.1121 6756.1282 40.75 54.32 0.34 12.95 7.054 0.000
AMDVQLHSPAFQFPDVDFLREGEDDRTVCKELRRNSTGCLKMKGQCEKCQELLSVDCS Clusterin Clu Q06890   MEROPS 6871.1801 6890.2217 39.42 55.38 3.38 13.42 7.049 0.000
KLQCENVQDMPVFG Disintegrin and metalloproteinase domain-containing protein 9 Adam9 Q61072 E9Q638 SignalP 1645.7592 1664.7772 34.40 53.13 0.26 13.81 7.045 0.000
GPQGQFRAPGPQGQMGPQGPPMHQGGGGPQGFMGPQGPQGPPQGLPRPQDMHGPQGMQRHPGPH pre-mRNA 3′ end processing protein WDR33 Wdr33 Q8K4P0   MEROPS 6509.0183 6528.0352 36.48 52.40 0.24 11.24 7.044 0.000
KEEEEQRRAEEQMLKERE Eukaryotic translation initiation factor 3 subunit A Eif3a P23116   MEROPS 2328.1128 2347.1170 24.79 49.11 6.10 13.98 7.043 0.000
ELVVQDGVTLLTKDEGPGSSLT X-ray repair cross-complementing protein 5 Xrcc5 P27641   MEROPS, SignalP 2239.1583 2258.1794 25.42 43.46 1.20 15.06 7.033 0.000
LNELDFYEAFMEEPMTLPDKPNSEEELVSFVEEHRRSTLRKLKPESMYETWEDD Calsequestrin-1 Casq1 O09165   SignalP 6560.0450 6579.0482 39.19 52.73 2.31 16.35 7.022 0.000
SEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDLQDNKFLEAGQFNDNL Disks large homolog 3 Dlg3 P70175   MEROPS 6645.1002 6664.1136 31.59 55.15 0.76 18.09 7.011 0.000
QQRGRSCDVTSNTCLGPSLQTRTCSLGKCDTRLRQNGGWSHWSPWSSCSVTCGVGNVTR Thrombospondin-2 Thbs2 Q03350   MEROPS 6737.0870 6756.1282 40.75 54.32 3.38 12.95 6.965 0.000
GKMCFQTLTDDDYKSELR Ephrin type-B receptor 1 Ephb1 Q8CBF3   MEROPS 2187.9929 2207.0319 38.08 46.90 9.43 16.34 6.879 0.017
GCYYYWNTQTNEVTWELPQYLATQVQGLQHYQPSSVTGTEAAFVVNTDMYTKERTT Formin-binding protein 4 Fnbp4 Q6ZQ03   MEROPS 6549.0270 6568.0537 38.36 53.02 1.26 14.37 6.879 0.017
VPFDGMWLDMNEPSNFVRGSQQGCPNNELENPPYVPGVVGGLLQAATLCASSHQFLSTHY Lysosomal alpha-glucosidase Gaa P70699   MEROPS 6614.0616 6633.0737 39.13 53.55 0.95 14.82 6.874 0.017
GYAANYCDGECSFPLNAHMNATNHALVQTLVHLMNPEYVPKPCCAPTKLNALSVLYFDD Bone morphogenetic protein 6 Bmp6 P20722   SignalP 6693.0782 6712.1155 37.19 58.90 2.83 12.66 6.869 0.017
GSGEQYRGSVSKTRKGVQCQHWSSETPHKPQFTPTSAPQAGLEANFCRNPDGDSHGPWC Hepatocyte growth factor-like protein Mst1 E0CXN0 P26928 SignalP 6577.9900 6597.0184 41.81 53.73 1.52 9.93 6.851 0.017
SCDSALRAYVKDHYSNGFCTVYAKTLDGQQTLLACLESHQFQPKNFWNGRWRSEW F-actin-capping protein subunit alpha-1 Capza1 P47753   MEROPS 6607.0861 6626.1144 41.74 52.74 1.49 17.04 6.846 0.017
GNVKMTLGMLWTLL Alpha-actinin-1 Actn1 Q7TPR4   MEROPS 1557.8411 1576.8527 46.69 71.65 4.37 11.30 6.804 0.017
YPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGV Galectin-3 Lgals3 P16110   MEROPS 6672.0973 6691.0977 39.09 53.61 2.70 12.38 6.801 0.029
TQAFYRVDLSLDFAEMDSPVHWTVE Protein Gm572 Gm572 B1ARY8   SignalP 2937.3643 2956.3656 26.01 45.98 5.82 13.96 6.800 0.029
FGSGQSSGLTSVSGETSGLSDLSG Aggrecan core protein Acan Q61282   MEROPS 2197.9975 2217.0301 39.32 46.73 6.47 14.94 6.788 0.029
FKASDLDGDLTATREEFTAF Reticulocalbin-1 Rcn1 Q05186   MEROPS 2215.0433 2234.0482 38.26 48.00 6.09 13.30 6.770 0.029
LYKLDDPSCPRPECYRSCGSSTPDEFPTDLPGTKGNFKLVRHVSFVDCPGHDLLMATM Eukaryotic translation initiation factor 2 subunit 3 X-linked Eif2s3x Q9Z0N1   MEROPS 6652.0840 6671.0899 38.48 52.88 1.88 13.61 6.767 0.029
VDTSFVEVTPTTFREEEGLGSVELSGFPSGETELSGTSGTVDVSEQSSGALDSSGLTSPTPEFSGL Aggrecan core protein Acan Q61282   MEROPS 6665.0991 6684.0975 40.09 53.32 3.00 9.91 6.733 0.029
AEFQPLVEEPKNLVKTN Serum albumin Alb P07724   MEROPS 1937.0258 1956.0455 30.40 47.82 0.68 13.34 6.662 0.037
ESNTNPTGWEPNEENEDETDKYPSFSGSG CD44 antigen Cd44 A2APM2   SignalP 3198.2810 3217.2710 36.64 74.43 8.87 12.00 6.655 0.037
RYNQLYTYGYGSVARYNSYQSFQTPQHPSFLFKDKQLSWSATYLPTMQSCWNYGF Galectin-3-binding protein Lgals3bp Q07797   MEROPS 6656.0848 6675.0796 41.58 53.17 3.54 16.89 6.651 0.037
KWNPETVESPGGVEDSQQCLEVEEGPEREQHQESLRSLGEVEWELPGSGSQQRWEDVV Nestin Nes Q6P5H2   MEROPS 6642.0541 6661.0878 39.38 53.41 2.30 11.11 6.639 0.037
RPSTMLCAGYLAGGLDSCQGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVT Serine protease 56 Prss56 F2YMG0   SignalP 6508.0191 6527.0477 38.22 52.51 1.57 15.34 6.634 0.037
STPTPTTTASSTASGSAPNPTTTVSSTASGSTPTLPTTASSSGSGSTPTLTTTESSTASGSSPTLTTTASSSA Protein Gm9573 Gm9573 F7C950   SignalP 6651.0814 6670.0954 38.21 53.40 0.65 15.36 6.631 0.037
SDGSSTPARATVTLNVTDVNDN Protein Pcdh9 Pcdh9 F8VPK8 A0A0A6YY09,A0A0A6YWY8,A0A0A6YWM0 SignalP 2215.0353 2234.0482 38.26 48.00 2.46 13.22 6.579 0.045
FKQDVFDFPACDVFTVEPGFDAALGQYLC Nuclear pore membrane glycoprotein 210 Nup210 A0A0R4J1I6 Q9QY81 SignalP 3337.5100 3356.5521 38.87 53.46 7.12 16.52 6.536 0.045
VVFVVLVLVLTGSLVALAYLCVLPLLLRTY Probable palmitoyltransferase ZDHHC16 Zdhhc16 Q9ESG8   SignalP 3297.9905 3317.0398 38.64 53.00 9.36 15.75 6.529 0.045
AEFQPLVEEPKNL Serum albumin Alb P07724   MEROPS 1494.7718 1513.7940 32.87 66.55 2.54 15.89 6.524 0.045
AEFQPLVEEPKNLVKTNCDLYEKLGEYGFQNA Serum albumin Alb P07724   MEROPS, SignalP 3724.8083 3743.8424 40.63 64.11 4.23 18.08 6.520 0.052
FSSLMNLEEKPAPAA Apolipoprotein A-II Apoa2 P09813   SignalP 1585.7810 1604.8040 31.21 70.02 2.90 15.31 6.505 0.052
LTSELTDERNTGESASQLLDAETA Unconventional myosin-XVIIIa Myo18a Q9JMH9   MEROPS 2532.1827 2551.1922 25.56 52.97 3.51 15.23 6.495 0.052
KARENPSEEAQNLVEFTDE Splicing factor 3A subunit 3 Sf3a3 Q9D554   MEROPS 2187.0080 2206.0304 38.60 47.30 1.84 14.08 6.462 0.059
DLVCSPVWTSRDRCCDLPSRRDEAKCPALPNACTCTQDSVGPPGPPGPAGGPGAKGPRGER Collagen alpha-1(XII) chain Col12a1 E9PX70 Q60847–5 SignalP 6581.0473 6600.0596 41.29 53.48 0.93 12.69 6.449 0.059
RGYEASVDSLTFGAVTGPDPSEEAGTKARFSLSDNVEEGSWSASVLDQQDNVLSLQLCTPAN Protein-glutamine gamma-glutamyltransferase 2 Tgm2 P21981   MEROPS 6554.0731 6573.0724 38.80 52.57 2.92 17.55 6.381 0.067
HPPPTSREDKSPSEESTTTTSPESLSGSVPSSG UV excision repair protein RAD23 homolog A Rad23a P54726   MEROPS 3336.5229 3355.5558 37.44 53.13 4.34 16.09 6.337 0.080
GRNQASAGSAPGAVLSQAMESTAVRPEETPRGLGDGLESSGTVQEPDAGGSSLEQDSQKQAEEKEQ Scavenger receptor class F member 1 Scarf1 Q5ND28   SignalP 6678.1247 6697.1335 36.12 52.95 1.44 18.93 6.328 0.080
KSQPKKFCDYCKCWLADNRPSVEFHE WW domain-binding protein 4 Wbp4 Q61048   MEROPS 3310.5110 3329.5493 39.73 53.65 6.01 14.28 6.327 0.080
TDGSFRCECPMGYNLDYTGVRCVDTDE Fibrillin-2 Fbn2 Q61555   MEROPS 3198.2787 3217.2710 36.64 74.43 8.16 12.38 6.304 0.084
SSERVSGAEPAPGTMSKHRGKPSAACRCCVTYCEGESHLRSKSRAEMHTHPQWETHL Isoform 3 of Interleukin-1 receptor accessory protein Il1rap Q61730–3   SignalP 6499.9797 6518.9949 38.98 52.98 0.48 14.82 6.285 0.084
LPFKNL Cholesterol side-chain cleavage enzyme mitochondrial Cyp11a1 Q9QZ82   MEROPS 712.4272 731.4462 52.82 109.68 0.87 17.99 6.244 0.094
NGLCVNSRGSFKCECPNGMTLDATGRLCLDLRLETCFLKYDDEECTLPLAGRHRMDA Fibrillin-1 Fbn1 Q61554   MEROPS 6674.0571 6693.0873 39.87 53.46 1.76 13.49 6.228 0.094
NGRLTCTSRNRCNDQDTRTSYRLGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHA Fibronectin Fn1 P11276   MEROPS 6596.0482 6615.0780 39.84 53.14 1.72 17.33 6.212 0.094
TVNPYTYPEDDYLPKFWVFFFKCSFSEFDCQLLENCQPNASLDLLPRHLFDPAMS Protein Vmn2r62 Vmn2r62 K7 N712   SignalP 6690.0785 6709.0974 42.18 53.73 0.08 17.11 6.206 0.094
KSGVGGMGGYPGPAGPPGPPGPPGSS Collagen alpha-1(III) chain Col3a1 P08121   MEROPS 2200.0371 2219.0434 41.73 48.05 5.49 18.01 6.165 0.095
SSLDGLLTEHGPFLL Lysosomal protective protein Ctsa P16675   MEROPS, SignalP 1579.8246 1598.8403 25.28 37.22 1.69 12.40 6.162 0.095
CSGSLVERRPCFSALTVD Serum albumin Alb P07724   MEROPS 2034.9615 2053.9827 29.23 47.08 1.38 11.05 6.072 0.097
LVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGACRQVQYPLTDLSPLLTSGDSDLS Hepatocyte growth factor receptor Met F8VQL0 P16056 SignalP 6645.1187 6664.1136 31.59 55.15 3.54 11.68 6.071 0.097
PFPTFSSTAVMAKETTAFEEGEGSTYTPSEGRLMTGSERVPGLETTPVGTSYPPGALTDQEVE Versican core protein Vcan Q62059   MEROPS 6606.0893 6625.0931 41.40 52.72 2.22 14.43 6.067 0.097
KLLLAFSLLLVLLLFQEQL Protein Vmn2r23 Vmn2r23 E9PXI5   SignalP 2195.3697 2214.3732 41.79 47.98 6.78 17.75 6.050 0.101
ELETSHLGKGCDRDTYSEKSLHRLCGAAAGTSELLPSPSSSFNWTVGLPTDNGHDSDQVFE Calsyntenin-1 Clstn1 Q9EPL2   MEROPS, SignalP 6644.0520 6663.0569 38.66 52.84 2.03 11.98 6.032 0.101
QATTQPSTTAGTSTTTTTTTTAA Ubiquilin-2 Ubqln2 Q9QZM0   MEROPS 2182.0237 2201.0355 39.22 47.21 3.03 13.97 6.025 0.101
PPASVVVGPVVVPR Alpha-2-HS-glycoprotein Ahsg Q3UEK9 P29699 SignalP 1353.8132 1372.8346 32.85 63.44 2.21 11.64 5.985 0.101
EEAPQPALPFQPDSPTHFTP Isoform 3 of Seizure protein 6 Sez6 Q7TSK2–3   SignalP 2187.0272 2206.0278 36.80 47.80 8.16 17.75 5.964 0.105
ATADAGSLSPRTCAALQKALDDDNDEKVSGSSDDLAEKMLLGSGLEQEEHADETAERGGGVPFD DNA repair protein complementing XP-G cells homolog Ercc5 P35689   MEROPS 6628.0364 6647.0762 38.70 52.58 3.22 17.40 5.952 0.105
  1. aPrecursor retention time
  2. bPrecursor drift time
  3. cPrecursor mass error in ppm
  4. dMaximum product mass error in ppm